Lineage for d5kank1 (5kan K:1-109)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757130Domain d5kank1: 5kan K:1-109 [326760]
    Other proteins in same PDB: d5kana_, d5kanb_, d5kanc_, d5kand_, d5kane_, d5kanf_, d5kani2, d5kank2, d5kanl2
    automated match to d2rcsl1
    complexed with nag

Details for d5kank1

PDB Entry: 5kan (more details), 2.79 Å

PDB Description: crystal structure of multidonor hv1-18-class broadly neutralizing influenza a antibody 16.g.07 in complex with a/hong kong/1-4-ma21- 1/1968 (h3n2) hemagglutinin
PDB Compounds: (K:) 16.g.07 Light chain

SCOPe Domain Sequences for d5kank1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kank1 b.1.1.0 (K:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqvpvslsafvgdrvsitcrasqdisrwlawyqqkpgrapklliyaasslqggvps
rfrgsgsgteftltisglqpedfatyycqqgstfpytsvlgtilgipgt

SCOPe Domain Coordinates for d5kank1:

Click to download the PDB-style file with coordinates for d5kank1.
(The format of our PDB-style files is described here.)

Timeline for d5kank1: