![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d5k9qy1: 5k9q Y:1-106 [326745] Other proteins in same PDB: d5k9qa_, d5k9qb_, d5k9qc_, d5k9qd_, d5k9qe_, d5k9qf_, d5k9qi2, d5k9qk2, d5k9ql2, d5k9qm_, d5k9qn_, d5k9qo_, d5k9qp_, d5k9qq_, d5k9qr_, d5k9qt2, d5k9qv2, d5k9qy2 automated match to d1dn0a1 complexed with nag |
PDB Entry: 5k9q (more details), 2.5 Å
SCOPe Domain Sequences for d5k9qy1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k9qy1 b.1.1.0 (Y:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspvslsasvgdrvtitcrasqsigkflnwyqqkpgrapklliyyasnletggps rfsgrgsetefsltisslqpedfatyycqqsnnvphtfgqgtklei
Timeline for d5k9qy1:
![]() Domains from other chains: (mouse over for more information) d5k9qa_, d5k9qb_, d5k9qc_, d5k9qd_, d5k9qe_, d5k9qf_, d5k9qg_, d5k9qh_, d5k9qi1, d5k9qi2, d5k9qj_, d5k9qk1, d5k9qk2, d5k9ql1, d5k9ql2, d5k9qm_, d5k9qn_, d5k9qo_, d5k9qp_, d5k9qq_, d5k9qr_, d5k9qs_, d5k9qt1, d5k9qt2, d5k9qu_, d5k9qv1, d5k9qv2, d5k9qx_ |