Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) nickel-dependent enzyme |
Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
Protein automated matches [190200] (9 species) not a true protein |
Species Streptococcus agalactiae [TaxId:1311] [326636] (10 PDB entries) |
Domain d5jf7a_: 5jf7 A: [326737] automated match to d3l87a_ complexed with 6ju, act, imd, zn |
PDB Entry: 5jf7 (more details), 2.1 Å
SCOPe Domain Sequences for d5jf7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jf7a_ d.167.1.1 (A:) automated matches {Streptococcus agalactiae [TaxId: 1311]} aaidklvkashlidmndiiregnptlrkvaeevtfplsekeeilgekmmqflkhsqdpim aeklglrggvglaapqldiskriiavlvpnvedaqgnppkeayslqevmynpkvvshsvq daalsdgegclsvdrevpgyvvrharvtieyfdktgekhrlklkgynsivvqheidhidg imfydrineknpfavkegllile
Timeline for d5jf7a_: