SCOPe 2.06: Domain d5lovf1: 5lov F:1-76

Lineage for d5lovf1 (5lov F:1-76)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)

6. Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [311384] (51 PDB entries)

8. Domain d5lovf1: 5lov F:1-76 [326732]
   Other proteins in same PDB: d5lova1, d5lova2, d5lovb1, d5lovb2, d5lovc1, d5lovc2, d5lovd1, d5lovd2, d5love_, d5lovf2
   automated match to d3tiia1
   complexed with 71e, acp, ca, gdp, gtp, mes, mg

Details for d5lovf1

PDB Entry: 5lov, 2.4 Å

PDB Description: dz-2384 tubulin complex

PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d5lovf1:

Sequence; same for both SEQRES and ATOM records:

>d5lovf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

Timeline for d5lovf1:

• d5lovf1 is new in SCOPe 2.06-stable
  
• d5lovf1 appears in SCOPe 2.07
  
• d5lovf1 appears in the current release, SCOPe 2.08