![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (60 species) not a true protein |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [186755] (3 PDB entries) |
![]() | Domain d5ls9h_: 5ls9 H: [326731] automated match to d2x17m_ complexed with mg |
PDB Entry: 5ls9 (more details), 2.93 Å
SCOPe Domain Sequences for d5ls9h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ls9h_ a.25.1.0 (H:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} asisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmfd fvserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatynf lqwyvaeqveeeasaldiveklrligedkrallfldkelslrq
Timeline for d5ls9h_: