Lineage for d5ls9h_ (5ls9 H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2703927Species Archaeoglobus fulgidus [TaxId:2234] [186755] (3 PDB entries)
  8. 2703946Domain d5ls9h_: 5ls9 H: [326731]
    automated match to d2x17m_
    complexed with mg

Details for d5ls9h_

PDB Entry: 5ls9 (more details), 2.93 Å

PDB Description: humanized archaeal ferritin
PDB Compounds: (H:) Ferritin, putative

SCOPe Domain Sequences for d5ls9h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ls9h_ a.25.1.0 (H:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
asisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmfd
fvserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatynf
lqwyvaeqveeeasaldiveklrligedkrallfldkelslrq

SCOPe Domain Coordinates for d5ls9h_:

Click to download the PDB-style file with coordinates for d5ls9h_.
(The format of our PDB-style files is described here.)

Timeline for d5ls9h_: