Lineage for d5ja7b_ (5ja7 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534811Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2534812Protein automated matches [190230] (23 species)
    not a true protein
  7. 2534862Species Human (Homo sapiens) [TaxId:9606] [187072] (51 PDB entries)
  8. 2534879Domain d5ja7b_: 5ja7 B: [326729]
    automated match to d4lega_
    complexed with 6hm, act, gol, so4; mutant

Details for d5ja7b_

PDB Entry: 5ja7 (more details), 1.61 Å

PDB Description: human cathepsin k mutant c25s in complex with the allosteric effector nsc94914
PDB Compounds: (B:) cathepsin k

SCOPe Domain Sequences for d5ja7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ja7b_ d.3.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yipewegrapdsvdyrkkgyvtpvknqgqcgsswafssvgalegqlkkktgkllnlspqn
lvdcvsendgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyre
ipegnekalkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiq
kgnkhwiiknswgenwgnkgyilmarnknnacgianlasfpkm

SCOPe Domain Coordinates for d5ja7b_:

Click to download the PDB-style file with coordinates for d5ja7b_.
(The format of our PDB-style files is described here.)

Timeline for d5ja7b_: