Lineage for d5ls9f_ (5ls9 F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317166Species Archaeoglobus fulgidus [TaxId:2234] [186755] (3 PDB entries)
  8. 2317183Domain d5ls9f_: 5ls9 F: [326728]
    automated match to d2x17m_
    complexed with mg

Details for d5ls9f_

PDB Entry: 5ls9 (more details), 2.93 Å

PDB Description: humanized archaeal ferritin
PDB Compounds: (F:) Ferritin, putative

SCOPe Domain Sequences for d5ls9f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ls9f_ a.25.1.0 (F:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmfdf
vserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatynfl
qwyvaeqveeeasaldiveklrligedkrallfldkelslrqftp

SCOPe Domain Coordinates for d5ls9f_:

Click to download the PDB-style file with coordinates for d5ls9f_.
(The format of our PDB-style files is described here.)

Timeline for d5ls9f_: