![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
![]() | Protein automated matches [190085] (51 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [326678] (1 PDB entry) |
![]() | Domain d5gy7b_: 5gy7 B: [326718] automated match to d1kvqa_ complexed with gol, nad, no3, udp; mutant |
PDB Entry: 5gy7 (more details), 1.43 Å
SCOPe Domain Sequences for d5gy7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gy7b_ c.2.1.2 (B:) automated matches {Escherichia coli [TaxId: 83333]} mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi fsssatvygdqpkipyvesfptgtpqspygksklmveqiltdlqkaqpdwsiallryfnp vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla dgivvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypd
Timeline for d5gy7b_: