SCOPe 2.08: Domain d5gy7b_: 5gy7 B:

Lineage for d5gy7b_ (5gy7 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein automated matches [190085] (59 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [326678] (1 PDB entry)

8. Domain d5gy7b_: 5gy7 B: [326718]
   automated match to d1kvqa_
   complexed with gol, nad, no3, udp; mutant

Details for d5gy7b_

PDB Entry: 5gy7, 1.43 Å

PDB Description: x-ray structure of h243i mutant of udp-galactose 4-epimerase from e.coli:evidence for existence of open and closed active site during catalysis.

PDB Compounds: (B:) UDP-glucose 4-epimerase

SCOPe Domain Sequences for d5gy7b_:

Sequence; same for both SEQRES and ATOM records:

>d5gy7b_ c.2.1.2 (B:) automated matches {Escherichia coli [TaxId: 83333]}
mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
fsssatvygdqpkipyvesfptgtpqspygksklmveqiltdlqkaqpdwsiallryfnp
vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
dgivvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw
adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypd

Timeline for d5gy7b_:

• d5gy7b_ first appeared in SCOPe 2.06
  
• d5gy7b_ appears in SCOPe 2.07