Lineage for d5lovc1 (5lov C:1-245)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) 
automatically mapped to Pfam PF00091Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) 
Protein automated matches [226837] (10 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [226564] (128 PDB entries) 
Domain d5lovc1: 5lov C:1-245 [326713]
Other proteins in same PDB: d5lova2, d5lovb2, d5lovc2, d5lovd2, d5love_, d5lovf1, d5lovf2, d5lovf3
automated match to d4ihja1
complexed with 71e, acp, ca, gdp, gtp, mes, mg
Details for d5lovc1
PDB Entry: 5lov (more details), 2.4 Å
PDB Description: dz-2384 tubulin complex
PDB Compounds: (C:) Tubulin alpha-1B chainSCOPe Domain Sequences for d5lovc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lovc1 c.32.1.1 (C:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd
SCOPe Domain Coordinates for d5lovc1:
Click to download the PDB-style file with coordinates for d5lovc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5lovc1:
View in 3D
