SCOPe 2.08: Domain d5llta1: 5llt A:3-205

Lineage for d5llta1 (5llt A:3-205)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (61 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [269943] (7 PDB entries)

8. Domain d5llta1: 5llt A:3-205 [326711]
   Other proteins in same PDB: d5llta2, d5lltb2
   automated match to d4ymia_
   complexed with dnd, edo, peg

Details for d5llta1

PDB Entry: 5llt, 2.2 Å

PDB Description: plasmodium falciparum nicotinic acid mononucleotide adenylyltransferase complexed with naad

PDB Compounds: (A:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d5llta1:

Sequence; same for both SEQRES and ATOM records:

>d5llta1 c.26.1.0 (A:3-205) automated matches {Plasmodium falciparum [TaxId: 36329]}
hkniciyggsfdpityahemvldkisnlnwiheiwvvicrcrndksltefhhrhnmftii
innsskiikskiflkdleshsemtptydllktqkelhpnytfyfglgsdlicdifswdeg
eklvlenafiiierghfkidesilkkfpkyylinipklsfinfisssearkfltkendin
dikkyihpltidyiikynlydfn

Timeline for d5llta1:

• d5llta1 first appeared in SCOPe 2.06
  
• d5llta1 appears in SCOPe 2.07