Lineage for d5llta1 (5llt A:3-205)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2861079Species Plasmodium falciparum [TaxId:36329] [269943] (7 PDB entries)
  8. 2861083Domain d5llta1: 5llt A:3-205 [326711]
    Other proteins in same PDB: d5llta2, d5lltb2
    automated match to d4ymia_
    complexed with dnd, edo, peg

Details for d5llta1

PDB Entry: 5llt (more details), 2.2 Å

PDB Description: plasmodium falciparum nicotinic acid mononucleotide adenylyltransferase complexed with naad
PDB Compounds: (A:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d5llta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5llta1 c.26.1.0 (A:3-205) automated matches {Plasmodium falciparum [TaxId: 36329]}
hkniciyggsfdpityahemvldkisnlnwiheiwvvicrcrndksltefhhrhnmftii
innsskiikskiflkdleshsemtptydllktqkelhpnytfyfglgsdlicdifswdeg
eklvlenafiiierghfkidesilkkfpkyylinipklsfinfisssearkfltkendin
dikkyihpltidyiikynlydfn

SCOPe Domain Coordinates for d5llta1:

Click to download the PDB-style file with coordinates for d5llta1.
(The format of our PDB-style files is described here.)

Timeline for d5llta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5llta2