Lineage for d5ktla1 (5ktl A:2-294)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2420459Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2421872Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2421873Protein automated matches [190115] (77 species)
    not a true protein
  7. 2421938Species Anabaena variabilis [TaxId:240292] [326701] (1 PDB entry)
  8. 2421939Domain d5ktla1: 5ktl A:2-294 [326708]
    Other proteins in same PDB: d5ktla2, d5ktlb2
    automated match to d4icna_
    complexed with mn

Details for d5ktla1

PDB Entry: 5ktl (more details), 1.92 Å

PDB Description: dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis.
PDB Compounds: (A:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d5ktla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ktla1 c.1.10.0 (A:2-294) automated matches {Anabaena variabilis [TaxId: 240292]}
gdfgtvltamitpfkadgsvnyavaaelaahlvdngtdtlvvcgttgesptlswdeeynl
fvevlqtvagkakviagcgsnstkeaiaatqkaakigvhgtlqvvpyynkppqaglyqhf
qaiaqacpdlplllynvpgrtgqnlspetvvrlaeidniigvxeasgnldqageirrstp
kefqiyagddsltlpllaigakgvvsvashlvgnqlqqmiqafnsgqvtvasdihlrllp
lfkalfittnpipikqalklqgwevgstrpplsdadaevsqkleavmkhlnli

SCOPe Domain Coordinates for d5ktla1:

Click to download the PDB-style file with coordinates for d5ktla1.
(The format of our PDB-style files is described here.)

Timeline for d5ktla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ktla2