| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (94 species) not a true protein |
| Species Anabaena variabilis [TaxId:240292] [326701] (1 PDB entry) |
| Domain d5ktlb1: 5ktl B:2-294 [326702] Other proteins in same PDB: d5ktla2, d5ktlb2 automated match to d4icna_ complexed with mn |
PDB Entry: 5ktl (more details), 1.92 Å
SCOPe Domain Sequences for d5ktlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ktlb1 c.1.10.0 (B:2-294) automated matches {Anabaena variabilis [TaxId: 240292]}
gdfgtvltamitpfkadgsvnyavaaelaahlvdngtdtlvvcgttgesptlswdeeynl
fvevlqtvagkakviagcgsnstkeaiaatqkaakigvhgtlqvvpyynkppqaglyqhf
qaiaqacpdlplllynvpgrtgqnlspetvvrlaeidniigvxeasgnldqageirrstp
kefqiyagddsltlpllaigakgvvsvashlvgnqlqqmiqafnsgqvtvasdihlrllp
lfkalfittnpipikqalklqgwevgstrpplsdadaevsqkleavmkhlnli
Timeline for d5ktlb1: