Lineage for d5ktlb1 (5ktl B:2-294)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836031Species Anabaena variabilis [TaxId:240292] [326701] (1 PDB entry)
  8. 2836033Domain d5ktlb1: 5ktl B:2-294 [326702]
    Other proteins in same PDB: d5ktla2, d5ktlb2
    automated match to d4icna_
    complexed with mn

Details for d5ktlb1

PDB Entry: 5ktl (more details), 1.92 Å

PDB Description: dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis.
PDB Compounds: (B:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d5ktlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ktlb1 c.1.10.0 (B:2-294) automated matches {Anabaena variabilis [TaxId: 240292]}
gdfgtvltamitpfkadgsvnyavaaelaahlvdngtdtlvvcgttgesptlswdeeynl
fvevlqtvagkakviagcgsnstkeaiaatqkaakigvhgtlqvvpyynkppqaglyqhf
qaiaqacpdlplllynvpgrtgqnlspetvvrlaeidniigvxeasgnldqageirrstp
kefqiyagddsltlpllaigakgvvsvashlvgnqlqqmiqafnsgqvtvasdihlrllp
lfkalfittnpipikqalklqgwevgstrpplsdadaevsqkleavmkhlnli

SCOPe Domain Coordinates for d5ktlb1:

Click to download the PDB-style file with coordinates for d5ktlb1.
(The format of our PDB-style files is described here.)

Timeline for d5ktlb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ktlb2