Lineage for d5h4ya_ (5h4y A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045100Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045101Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2045347Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2045348Protein automated matches [190497] (4 species)
    not a true protein
  7. 2045351Species Human (Homo sapiens) [TaxId:9606] [188711] (22 PDB entries)
  8. 2045362Domain d5h4ya_: 5h4y A: [326685]
    automated match to d1w15a_
    complexed with act, ca

Details for d5h4ya_

PDB Entry: 5h4y (more details), 1.9 Å

PDB Description: crystal structure of human synaptotagmin 5 c2a domain
PDB Compounds: (A:) Synaptotagmin-5

SCOPe Domain Sequences for d5h4ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h4ya_ b.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
helgqlqysldydfqsgqllvgilqamglaaldlggssdpyvrvyllpdkrrryetkvhr
qtlnphfgetfafkvpyvelggrvlvmavydfdrfsrndaigevrvpmssvdlgrpvqaw
relqaap

SCOPe Domain Coordinates for d5h4ya_:

Click to download the PDB-style file with coordinates for d5h4ya_.
(The format of our PDB-style files is described here.)

Timeline for d5h4ya_: