Lineage for d5k9qi1 (5k9q I:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756593Domain d5k9qi1: 5k9q I:1-106 [326681]
    Other proteins in same PDB: d5k9qa_, d5k9qb_, d5k9qc_, d5k9qd_, d5k9qe_, d5k9qf_, d5k9qi2, d5k9qk2, d5k9ql2, d5k9qm_, d5k9qn_, d5k9qo_, d5k9qp_, d5k9qq_, d5k9qr_, d5k9qt2, d5k9qv2, d5k9qy2
    automated match to d1dn0a1
    complexed with nag

Details for d5k9qi1

PDB Entry: 5k9q (more details), 2.5 Å

PDB Description: crystal structure of multidonor hv1-18-class broadly neutralizing influenza a antibody 16.a.26 in complex with a/hong kong/1-4-ma21- 1/1968 (h3n2) hemagglutinin
PDB Compounds: (I:) 16.a.26 Light chain

SCOPe Domain Sequences for d5k9qi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k9qi1 b.1.1.0 (I:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspvslsasvgdrvtitcrasqsigkflnwyqqkpgrapklliyyasnletggps
rfsgrgsetefsltisslqpedfatyycqqsnnvphtfgqgtklei

SCOPe Domain Coordinates for d5k9qi1:

Click to download the PDB-style file with coordinates for d5k9qi1.
(The format of our PDB-style files is described here.)

Timeline for d5k9qi1: