SCOP 1.57: Domain d1c86a_: 1c86 A:

Lineage for d1c86a_ (1c86 A:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families)

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins)

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (27 PDB entries)

8. Domain d1c86a_: 1c86 A: [32668]

Details for d1c86a_

PDB Entry: 1c86, 2.3 Å

PDB Description: crystal structure of protein tyrosine phosphatase 1b (r47v,d48n) complexed with 2-(oxalyl-amino-4,7-dihydro-5h-thieno[2,3-c]pyran-3- carboxylic acid

SCOP Domain Sequences for d1c86a_:

Sequence; same for both SEQRES and ATOM records:

>d1c86a_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
mekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryvnvspfdhsriklhqe
dndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkca
qywpqkeekemifedtnlkltlisediktyytvrqlelenlttqetreilhfhyttwpdf
gvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdps
svdikkvlldmrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed

Timeline for d1c86a_:

• d1c86a_ first appeared (with stable ids) in SCOP 1.55
  
• d1c86a_ appears in SCOP 1.59
  
• d1c86a_ appears in the current release, SCOPe 2.08