Lineage for d5jf3a_ (5jf3 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2606868Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 2606994Protein automated matches [190200] (10 species)
    not a true protein
  7. 2607037Species Streptococcus agalactiae [TaxId:1311] [326636] (10 PDB entries)
  8. 2607038Domain d5jf3a_: 5jf3 A: [326665]
    automated match to d3l87a_
    complexed with act, imd, sf5, zn

Details for d5jf3a_

PDB Entry: 5jf3 (more details), 1.6 Å

PDB Description: crystal structure of type 2 pdf from streptococcus agalactiae in complex with inhibitor at018
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d5jf3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jf3a_ d.167.1.1 (A:) automated matches {Streptococcus agalactiae [TaxId: 1311]}
aaidklvkashlidmndiiregnptlrkvaeevtfplsekeeilgekmmqflkhsqdpim
aeklglrggvglaapqldiskriiavlvpnvedaqgnppkeayslqevmynpkvvshsvq
daalsdgegclsvdrevpgyvvrharvtieyfdktgekhrlklkgynsivvqheidhidg
imfydrineknpfavkegllile

SCOPe Domain Coordinates for d5jf3a_:

Click to download the PDB-style file with coordinates for d5jf3a_.
(The format of our PDB-style files is described here.)

Timeline for d5jf3a_: