SCOPe 2.08: Domain d5iwda1: 5iwd A:3-135

Lineage for d5iwda1 (5iwd A:3-135)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein UL44 [111176] (2 species)

7. Species Human cytomegalovirus (strain ad169) [TaxId:10360] [326638] (2 PDB entries)

8. Domain d5iwda1: 5iwd A:3-135 [326655]
   automated match to d1yypa1
   protein/DNA complex; complexed with 6ev

Details for d5iwda1

PDB Entry: 5iwd, 2.56 Å

PDB Description: hcmv dna polymerase subunit ul44 complex with a small molecule

PDB Compounds: (A:) DNA polymerase processivity factor

SCOPe Domain Sequences for d5iwda1:

Sequence; same for both SEQRES and ATOM records:

>d5iwda1 d.131.1.2 (A:3-135) UL44 {Human cytomegalovirus (strain ad169) [TaxId: 10360]}
rkdrlsepptlalrlkpyktaiqqlrsviralkenttvtflptpslilqtvrshcvskit
fnssclyitdksfqpktinnstpllgnfmyltsskdltkfyvqdisdlsakismcapdfn
mefssacvhgqdi

Timeline for d5iwda1:

• d5iwda1 first appeared in SCOPe 2.06
  
• d5iwda1 appears in SCOPe 2.07