Lineage for d1ptva_ (1ptv A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486243Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 486244Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 486283Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (5 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 486309Protein Tyrosine phosphatase [52806] (7 species)
  7. 486310Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (62 PDB entries)
  8. 486337Domain d1ptva_: 1ptv A: [32665]

Details for d1ptva_

PDB Entry: 1ptv (more details), 2.3 Å

PDB Description: crystal structure of protein tyrosine phosphatase 1b complexed with phosphotyrosine

SCOP Domain Sequences for d1ptva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ptva_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediktyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhssagigrsgtfcladtclllmdkrkdp
ssvdikkvlldmrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed

SCOP Domain Coordinates for d1ptva_:

Click to download the PDB-style file with coordinates for d1ptva_.
(The format of our PDB-style files is described here.)

Timeline for d1ptva_: