SCOPe 2.06: Domain d5j41a1: 5j41 A:1-76

Lineage for d5j41a1 (5j41 A:1-76)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (59 PDB entries)

8. Domain d5j41a1: 5j41 A:1-76 [326649]
   Other proteins in same PDB: d5j41a2, d5j41b2
   automated match to d1aqwa2
   complexed with 3lf, gsh, mes

Details for d5j41a1

PDB Entry: 5j41, 1.19 Å

PDB Description: glutathione s-transferase bound with hydrolyzed piperlongumine

PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d5j41a1:

Sequence; same for both SEQRES and ATOM records:

>d5j41a1 c.47.1.5 (A:1-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

Timeline for d5j41a1:

• d5j41a1 is new in SCOPe 2.06-stable
  
• d5j41a1 appears in SCOPe 2.07
  
• d5j41a1 appears in the current release, SCOPe 2.08