SCOPe 2.06: Domain d5exqb_: 5exq B:

Lineage for d5exqb_ (5exq B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109644] (9 PDB entries)
   Uniprot P99999

8. Domain d5exqb_: 5exq B: [326648]
   automated match to d3zcfa_
   complexed with hem, so4

Details for d5exqb_

PDB Entry: 5exq, 1.6 Å

PDB Description: human cytochrome c y48h

PDB Compounds: (B:) cytochrome c

SCOPe Domain Sequences for d5exqb_:

Sequence; same for both SEQRES and ATOM records:

>d5exqb_ a.3.1.1 (B:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgyshtaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

Timeline for d5exqb_:

• d5exqb_ is new in SCOPe 2.06-stable
  
• d5exqb_ appears in SCOPe 2.07
  
• d5exqb_ appears in the current release, SCOPe 2.08