SCOPe 2.08: Domain d5ixab2: 5ixa B:136-272

Lineage for d5ixab2 (5ixa B:136-272)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein UL44 [111176] (2 species)

7. Species Human cytomegalovirus (strain ad169) [TaxId:10360] [326638] (2 PDB entries)

8. Domain d5ixab2: 5ixa B:136-272 [326640]
   automated match to d1t6la2

Details for d5ixab2

PDB Entry: 5ixa, 2.68 Å

PDB Description: hcmv dna polymerase processivity subunit ul44 at neutral ph and low salt

PDB Compounds: (B:) DNA polymerase processivity factor

SCOPe Domain Sequences for d5ixab2:

Sequence, based on SEQRES records:

>d5ixab2 d.131.1.2 (B:136-272) UL44 {Human cytomegalovirus (strain ad169) [TaxId: 10360]}
vresensavhvdldfgvvadllkwigphtrvkrnvkkapcptgtvqilvhagppaikfil
tngseleftsnnrvsfhgvknmrinvqlknfyqtllncavtklpctlrivtehdtllyva
srnglfavenflteepf

Sequence, based on observed residues (ATOM records):

>d5ixab2 d.131.1.2 (B:136-272) UL44 {Human cytomegalovirus (strain ad169) [TaxId: 10360]}
vresensavhvdldfgvvadllkwigptgtvqilvhagppaikfiltngseleftsnnrv
sfhgvknmrinvqlknfyqtllncavtklpctlrivtehdtllyvasrnglfavenflte
epf

Timeline for d5ixab2:

• d5ixab2 first appeared in SCOPe 2.06
  
• d5ixab2 appears in SCOPe 2.07