![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.305: NAP-like [143112] (1 superfamily) core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix |
![]() | Superfamily d.305.1: NAP-like [143113] (2 families) ![]() |
![]() | Family d.305.1.0: automated matches [196445] (1 protein) not a true family |
![]() | Protein automated matches [196446] (6 species) not a true protein |
![]() | Species Schizosaccharomyces pombe [TaxId:284812] [326619] (2 PDB entries) |
![]() | Domain d5gpla_: 5gpl A: [326623] automated match to d2e50b_ |
PDB Entry: 5gpl (more details), 2.1 Å
SCOPe Domain Sequences for d5gpla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gpla_ d.305.1.0 (A:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]} eaaqafenlanleqefgkaeieilkkqnelfqplfeqrrdilktinnfwvvvleaagdei sqyitpedsvllekleniyverfnekeprdvrisltfqpneylqddnltlvkevrikeek akddeglekkitkytsqpvdihwkpgkslfrknkklppnffdyfqwtgeeedddfdgatl tiflaedlfpnavkyfteamteeasd
Timeline for d5gpla_: