Lineage for d5euib_ (5eui B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687755Species Ochotona princeps [TaxId:9978] [346154] (1 PDB entry)
  8. 2687756Domain d5euib_: 5eui B: [326617]
    Other proteins in same PDB: d5euia_
    automated match to d3lqdb_
    complexed with hem

Details for d5euib_

PDB Entry: 5eui (more details), 1.45 Å

PDB Description: structure of predicted ancestral pika hemoglobin
PDB Compounds: (B:) HBB protein

SCOPe Domain Sequences for d5euib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5euib_ a.1.1.2 (B:) Hemoglobin, beta-chain {Ochotona princeps [TaxId: 9978]}
vhlsgeekaavtalwgkvnvdevggetlgrllvvypwtqrffetfgdlssasavmgnakv
kahgkkvmnafseglhhldnlkgtfaklselhcdklhvdpenfkllgnvlvvvlshhlgg
eftpqaqaawqkvvsgvanalahkyh

SCOPe Domain Coordinates for d5euib_:

Click to download the PDB-style file with coordinates for d5euib_.
(The format of our PDB-style files is described here.)

Timeline for d5euib_: