Lineage for d1c88a_ (1c88 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70682Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
  4. 70683Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) (S)
  5. 70708Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins)
  6. 70719Protein Tyrosine phosphatase [52806] (7 species)
  7. 70720Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (27 PDB entries)
  8. 70726Domain d1c88a_: 1c88 A: [32659]

Details for d1c88a_

PDB Entry: 1c88 (more details), 1.8 Å

PDB Description: crystal structure of protein tyrosine phosphatase 1b complexed with 2- (oxalyl-amino)-4,5,6,7-tetrahydro-thieno[2,3-c]pyridine-3-carboxylic acid

SCOP Domain Sequences for d1c88a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c88a_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediktyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvlldmrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed

SCOP Domain Coordinates for d1c88a_:

Click to download the PDB-style file with coordinates for d1c88a_.
(The format of our PDB-style files is described here.)

Timeline for d1c88a_: