| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) ![]() |
| Family a.4.13.1: Sigma3 domain [88660] (3 proteins) |
| Protein Sigma70 [88661] (2 species) |
| Species Thermus thermophilus [TaxId:274] [88662] (11 PDB entries) Uniprot Q9WX78 |
| Domain d5tmcf2: 5tmc F:258-318 [326589] Other proteins in same PDB: d5tmca1, d5tmca2, d5tmcb1, d5tmcb2, d5tmcc_, d5tmcd_, d5tmce_, d5tmcf1, d5tmcf3 automated match to d1smyf1 complexed with g4p, mg, po4, zn |
PDB Entry: 5tmc (more details), 2.71 Å
SCOPe Domain Sequences for d5tmcf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tmcf2 a.4.13.1 (F:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e
Timeline for d5tmcf2: