| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
| Family a.16.1.0: automated matches [326419] (1 protein) not a true family |
| Protein automated matches [326420] (1 species) not a true protein |
| Species Influenza A virus (a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId:1129347] [326421] (1 PDB entry) |
| Domain d5h5nb_: 5h5n B: [326578] automated match to d2z0aa_ |
PDB Entry: 5h5n (more details), 2 Å
SCOPe Domain Sequences for d5h5nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h5nb_ a.16.1.0 (B:) automated matches {Influenza A virus (a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId: 1129347]}
epnpttiafqvdcylwhlkktlsmmgevdapfedrlrreqkalkgrsmtlgidiqsatqe
gyykiksitee
Timeline for d5h5nb_: