Lineage for d5h5nb_ (5h5n B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697722Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2697723Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2697846Family a.16.1.0: automated matches [326419] (1 protein)
    not a true family
  6. 2697847Protein automated matches [326420] (1 species)
    not a true protein
  7. 2697848Species Influenza A virus (a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId:1129347] [326421] (1 PDB entry)
  8. 2697850Domain d5h5nb_: 5h5n B: [326578]
    automated match to d2z0aa_

Details for d5h5nb_

PDB Entry: 5h5n (more details), 2 Å

PDB Description: the crystal structure of the ns1 (h17n10) rna-binding domain
PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d5h5nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h5nb_ a.16.1.0 (B:) automated matches {Influenza A virus (a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId: 1129347]}
epnpttiafqvdcylwhlkktlsmmgevdapfedrlrreqkalkgrsmtlgidiqsatqe
gyykiksitee

SCOPe Domain Coordinates for d5h5nb_:

Click to download the PDB-style file with coordinates for d5h5nb_.
(The format of our PDB-style files is described here.)

Timeline for d5h5nb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5h5na_