Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
Protein automated matches [190197] (24 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:485] [326531] (1 PDB entry) |
Domain d5tw7c1: 5tw7 C:2-197 [326563] Other proteins in same PDB: d5tw7a2, d5tw7a3, d5tw7b2, d5tw7b3, d5tw7c2, d5tw7c3, d5tw7c4, d5tw7d2, d5tw7d3, d5tw7e2, d5tw7e3, d5tw7f2, d5tw7f3, d5tw7f4 automated match to d1gpma2 complexed with mg |
PDB Entry: 5tw7 (more details), 2.35 Å
SCOPe Domain Sequences for d5tw7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tw7c1 c.23.16.0 (C:2-197) automated matches {Neisseria gonorrhoeae [TaxId: 485]} tqdkilildfgsqvtrliarrvreahvycelhsfdmpldeikafnpkgiilsggpnsvye sdyqadtgifdlgipvlgicygmqfmahhlggevqpgnqrefgyaqvktidsgltrgiqd dapntldvwmshgdkvsklpdgfavigdtpscpiammentekqfygiqfhpevthtkqgr allnrfvldicgaqpg
Timeline for d5tw7c1: