Lineage for d5ep7a1 (5ep7 A:1081-1197)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706695Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2706696Protein CREB-binding protein, CBP [74712] (2 species)
  7. 2706697Species Human (Homo sapiens) [TaxId:9606] [74713] (59 PDB entries)
  8. 2706705Domain d5ep7a1: 5ep7 A:1081-1197 [326555]
    Other proteins in same PDB: d5ep7a2
    automated match to d4nyva_
    complexed with 5qr

Details for d5ep7a1

PDB Entry: 5ep7 (more details), 1.2 Å

PDB Description: crystal structure of the bromodomain of human crebbp in complex with un32
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d5ep7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ep7a1 a.29.2.1 (A:1081-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

SCOPe Domain Coordinates for d5ep7a1:

Click to download the PDB-style file with coordinates for d5ep7a1.
(The format of our PDB-style files is described here.)

Timeline for d5ep7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ep7a2