SCOPe 2.08: Domain d5t6db_: 5t6d B:

Lineage for d5t6db_ (5t6d B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species Norwalk virus [TaxId:524364] [313606] (14 PDB entries)

8. Domain d5t6db_: 5t6d B: [326550]
   Other proteins in same PDB: d5t6da2
   automated match to d2fyqa_
   complexed with n38

Details for d5t6db_

PDB Entry: 5t6d, 2.1 Å

PDB Description: 2.10 a resolution structure of norovirus 3cl protease in complex with the dipeptidyl inhibitor 7l (hexagonal form)

PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d5t6db_:

Sequence, based on SEQRES records:

>d5t6db_ b.47.1.4 (B:) automated matches {Norwalk virus [TaxId: 524364]}
tlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrfskk
mrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmllt
ganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavq

Sequence, based on observed residues (ATOM records):

>d5t6db_ b.47.1.4 (B:) automated matches {Norwalk virus [TaxId: 524364]}
tlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrfskk
mrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmllt
lgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavq

Timeline for d5t6db_:

• d5t6db_ first appeared in SCOPe 2.06
  
• d5t6db_ appears in SCOPe 2.07