Lineage for d5ts9e_ (5ts9 E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732498Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2732499Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2732568Family a.130.1.0: automated matches [237401] (1 protein)
    not a true family
  6. 2732569Protein automated matches [237402] (7 species)
    not a true protein
  7. 2732590Species Paraburkholderia phymatum [TaxId:391038] [326517] (1 PDB entry)
  8. 2732595Domain d5ts9e_: 5ts9 E: [326547]
    automated match to d4oj7a_

Details for d5ts9e_

PDB Entry: 5ts9 (more details), 1.95 Å

PDB Description: crystal structure of chorismate mutase from burkholderia phymatum
PDB Compounds: (E:) chorismate mutase

SCOPe Domain Sequences for d5ts9e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ts9e_ a.130.1.0 (E:) automated matches {Paraburkholderia phymatum [TaxId: 391038]}
qqdafvplvrsmadrlntadqvalskwdtgqpvydgqreaqvianaatmaseygltaeda
inifsdqveankevqyallnnwrrqgdapatprqslagvirpildklqasimqnlqsvap
lrsiadchalvasavgqvaeqasldvlhraaldravaricv

SCOPe Domain Coordinates for d5ts9e_:

Click to download the PDB-style file with coordinates for d5ts9e_.
(The format of our PDB-style files is described here.)

Timeline for d5ts9e_: