SCOP 1.73: Domain d1mkpa_: 1mkp A:

Lineage for d1mkpa_ (1mkp A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (8 proteins)

6. Protein Mapk phosphatase [52803] (2 species)

7. Species Human (Homo sapiens), pyst1 (mkp3) [TaxId:9606] [52804] (1 PDB entry)

8. Domain d1mkpa_: 1mkp A: [32654]
   complexed with cl, mpd; mutant

Details for d1mkpa_

PDB Entry: 1mkp, 2.35 Å

PDB Description: crystal structure of pyst1 (mkp3)

PDB Compounds: (A:) pyst1

SCOP Domain Sequences for d1mkpa_:

Sequence; same for both SEQRES and ATOM records:

>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]}
asfpveilpflylgcakdstnldvleefgikyilnvtpnlpnlfenagefkykqipisdh
wsqnlsqffpeaisfideargkncgvlvhslagisrsvtvtvaylmqklnlsmndaydiv
kmkksnispnfnfmgqlldfertl

Timeline for d1mkpa_:

• d1mkpa_ first appeared (with stable ids) in SCOP 1.55, called d1mkp__
  
• d1mkpa_ was called d1mkp__ in SCOP 1.71
  
• d1mkpa_ appears in SCOP 1.75
  
• d1mkpa_ appears in the current release, SCOPe 2.08