SCOP 1.69: Domain d1mkp__: 1mkp -

Lineage for d1mkp__ (1mkp -)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (7 proteins)

6. Protein Mapk phosphatase [52803] (2 species)

7. Species Human (Homo sapiens), pyst1 (mkp3) [TaxId:9606] [52804] (1 PDB entry)

8. Domain d1mkp__: 1mkp - [32654]

Details for d1mkp__

PDB Entry: 1mkp, 2.35 Å

PDB Description: crystal structure of pyst1 (mkp3)

SCOP Domain Sequences for d1mkp__:

Sequence; same for both SEQRES and ATOM records:

>d1mkp__ c.45.1.1 (-) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3)}
asfpveilpflylgcakdstnldvleefgikyilnvtpnlpnlfenagefkykqipisdh
wsqnlsqffpeaisfideargkncgvlvhslagisrsvtvtvaylmqklnlsmndaydiv
kmkksnispnfnfmgqlldfertl

Timeline for d1mkp__:

• d1mkp__ first appeared (with stable ids) in SCOP 1.55
  
• d1mkp__ appears in SCOP 1.67
  
• d1mkp__ appears in SCOP 1.71
  
• d1mkp__ appears in the current release, SCOPe 2.08, called d1mkpa_