Lineage for d1mkp__ (1mkp -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395608Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 395609Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 395610Family c.45.1.1: Dual specificity phosphatase-like [52800] (7 proteins)
  6. 395620Protein Mapk phosphatase [52803] (2 species)
  7. 395623Species Human (Homo sapiens), pyst1 (mkp3) [TaxId:9606] [52804] (1 PDB entry)
  8. 395624Domain d1mkp__: 1mkp - [32654]
    complexed with cl, mpd; mutant

Details for d1mkp__

PDB Entry: 1mkp (more details), 2.35 Å

PDB Description: crystal structure of pyst1 (mkp3)

SCOP Domain Sequences for d1mkp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkp__ c.45.1.1 (-) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3)}
asfpveilpflylgcakdstnldvleefgikyilnvtpnlpnlfenagefkykqipisdh
wsqnlsqffpeaisfideargkncgvlvhslagisrsvtvtvaylmqklnlsmndaydiv
kmkksnispnfnfmgqlldfertl

SCOP Domain Coordinates for d1mkp__:

Click to download the PDB-style file with coordinates for d1mkp__.
(The format of our PDB-style files is described here.)

Timeline for d1mkp__: