![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1432 |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
![]() | Family c.45.1.1: Dual specificity phosphatase-like [52800] (5 proteins) |
![]() | Protein Mapk phosphatase [52803] (2 species) |
![]() | Species Human (Homo sapiens), pyst1 (mkp3) [TaxId:9606] [52804] (1 PDB entry) |
![]() | Domain d1mkp__: 1mkp - [32654] complexed with cl, mpd; mutant |
PDB Entry: 1mkp (more details), 2.35 Å
SCOP Domain Sequences for d1mkp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mkp__ c.45.1.1 (-) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3)} asfpveilpflylgcakdstnldvleefgikyilnvtpnlpnlfenagefkykqipisdh wsqnlsqffpeaisfideargkncgvlvhslagisrsvtvtvaylmqklnlsmndaydiv kmkksnispnfnfmgqlldfertl
Timeline for d1mkp__: