Lineage for d1mkp__ (1mkp -)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) 
Family c.45.1.1: Dual specificity phosphatase-like [52800] (5 proteins) 
Protein Mapk phosphatase [52803] (2 species) Species Human (Homo sapiens), pyst1 (mkp3) [TaxId:9606] [52804] (1 PDB entry) 
Domain d1mkp__: 1mkp - [32654]
Details for d1mkp__
PDB Entry: 1mkp (more details), 2.35 Å
PDB Description: crystal structure of pyst1 (mkp3)
SCOP Domain Sequences for d1mkp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mkp__ c.45.1.1 (-) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3)}
asfpveilpflylgcakdstnldvleefgikyilnvtpnlpnlfenagefkykqipisdh
wsqnlsqffpeaisfideargkncgvlvhslagisrsvtvtvaylmqklnlsmndaydiv
kmkksnispnfnfmgqlldfertl
SCOP Domain Coordinates for d1mkp__:
Click to download the PDB-style file with coordinates for d1mkp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mkp__:
- d1mkp__ first appeared (with stable ids) in SCOP 1.55
- d1mkp__ appears in SCOP 1.59
- d1mkp__ appears in SCOP 1.63
- d1mkp__ appears in the current release, SCOPe 2.08, called d1mkpa_
View in 3D