Lineage for d1mkp__ (1mkp -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24013Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
  4. 24014Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) (S)
  5. 24015Family c.45.1.1: Dual-specificity phosphatases [52800] (2 proteins)
  6. 24016Protein Mapk phosphotase Pyst1 (mkp3) [52803] (1 species)
  7. 24017Species Human (Homo sapiens) [TaxId:9606] [52804] (1 PDB entry)
  8. 24018Domain d1mkp__: 1mkp - [32654]

Details for d1mkp__

PDB Entry: 1mkp (more details), 2.35 Å

PDB Description: crystal structure of pyst1 (mkp3)

SCOP Domain Sequences for d1mkp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkp__ c.45.1.1 (-) Mapk phosphotase Pyst1 (mkp3) {Human (Homo sapiens)}
asfpveilpflylgcakdstnldvleefgikyilnvtpnlpnlfenagefkykqipisdh
wsqnlsqffpeaisfideargkncgvlvhslagisrsvtvtvaylmqklnlsmndaydiv
kmkksnispnfnfmgqlldfertl

SCOP Domain Coordinates for d1mkp__:

Click to download the PDB-style file with coordinates for d1mkp__.
(The format of our PDB-style files is described here.)

Timeline for d1mkp__: