Lineage for d5tmce_ (5tmc E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734750Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2734751Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2734752Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 2734753Protein RNA polymerase omega subunit [63564] (3 species)
  7. 2734771Species Thermus thermophilus [TaxId:274] [74729] (11 PDB entries)
    Uniprot Q8RQE7; part of multichain biological unit
  8. 2734788Domain d5tmce_: 5tmc E: [326530]
    Other proteins in same PDB: d5tmca1, d5tmca2, d5tmcb1, d5tmcb2, d5tmcc_, d5tmcd_, d5tmcf1, d5tmcf2, d5tmcf3
    automated match to d1smye_
    complexed with g4p, mg, po4, zn

Details for d5tmce_

PDB Entry: 5tmc (more details), 2.71 Å

PDB Description: re-refinement of thermus thermopiles dna-directed rna polymerase structure
PDB Compounds: (E:) DNA-directed RNA polymerase subunit omega

SCOPe Domain Sequences for d5tmce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmce_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

SCOPe Domain Coordinates for d5tmce_:

Click to download the PDB-style file with coordinates for d5tmce_.
(The format of our PDB-style files is described here.)

Timeline for d5tmce_: