![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
![]() | Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
![]() | Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins) 4 helices; irregular array |
![]() | Protein RNA polymerase omega subunit [63564] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [74729] (11 PDB entries) Uniprot Q8RQE7; part of multichain biological unit |
![]() | Domain d5tmce_: 5tmc E: [326530] Other proteins in same PDB: d5tmca1, d5tmca2, d5tmcb1, d5tmcb2, d5tmcc_, d5tmcd_, d5tmcf1, d5tmcf2, d5tmcf3 automated match to d1smye_ complexed with g4p, mg, po4, zn |
PDB Entry: 5tmc (more details), 2.71 Å
SCOPe Domain Sequences for d5tmce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tmce_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]} aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae twamkelltgrlvfgenlvpedrlqkemeriypge
Timeline for d5tmce_: