| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
| Protein Enolase [54828] (10 species) |
| Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (15 PDB entries) Uniprot P09104 |
| Domain d5eu9h1: 5eu9 H:2-140 [326526] Other proteins in same PDB: d5eu9a2, d5eu9b2, d5eu9c2, d5eu9c3, d5eu9d2, d5eu9e2, d5eu9f2, d5eu9f3, d5eu9g2, d5eu9h2 automated match to d2akza2 complexed with 5tx, mg, pge |
PDB Entry: 5eu9 (more details), 2.05 Å
SCOPe Domain Sequences for d5eu9h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eu9h1 d.54.1.1 (H:2-140) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn
Timeline for d5eu9h1: