![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
![]() | Superfamily a.130.1: Chorismate mutase II [48600] (5 families) ![]() |
![]() | Family a.130.1.0: automated matches [237401] (1 protein) not a true family |
![]() | Protein automated matches [237402] (7 species) not a true protein |
![]() | Species Paraburkholderia phymatum [TaxId:391038] [326517] (1 PDB entry) |
![]() | Domain d5ts9a_: 5ts9 A: [326524] automated match to d4oj7a_ |
PDB Entry: 5ts9 (more details), 1.95 Å
SCOPe Domain Sequences for d5ts9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ts9a_ a.130.1.0 (A:) automated matches {Paraburkholderia phymatum [TaxId: 391038]} gaqqdafvplvrsmadrlntadqvalskwdtgqpvydgqreaqvianaatmaseygltae dainifsdqveankevqyallnnwrrqgdapatprqslagvirpildklqasimqnlqsv aplrsiadchalvasavgqvaeqasldvlhraaldravaricvk
Timeline for d5ts9a_: