Lineage for d1vhrb_ (1vhr B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483040Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2483041Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2483042Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 2483093Protein VH1-related dual-specificity phosphatase, VHR [52801] (1 species)
  7. 2483094Species Human (Homo sapiens) [TaxId:9606] [52802] (4 PDB entries)
  8. 2483097Domain d1vhrb_: 1vhr B: [32652]
    complexed with epe, so4

Details for d1vhrb_

PDB Entry: 1vhr (more details), 2.1 Å

PDB Description: human vh1-related dual-specificity phosphatase
PDB Compounds: (B:) human vh1-related dual-specificity phosphatase vhr

SCOPe Domain Sequences for d1vhrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhrb_ c.45.1.1 (B:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]}
svqdlndllsdgsgcyslpsqpcnevtpriyvgnasvaqdipklqklgithvlnaaegrs
fmhvntnanfykdsgitylgikandtqefnlsayferaadfidqalaqkngrvlvhcreg
ysrsptlviaylmmrqkmdvksalsivrqnreigpndgflaqlcqlndrlakegklkp

SCOPe Domain Coordinates for d1vhrb_:

Click to download the PDB-style file with coordinates for d1vhrb_.
(The format of our PDB-style files is described here.)

Timeline for d1vhrb_: