Lineage for d1vhrb_ (1vhr B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) 
Family c.45.1.1: Dual-specificity phosphatases [52800] (2 proteins) Protein VH1-related dual-specificity phosphatase, VHR [52801] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52802] (2 PDB entries) 
Domain d1vhrb_: 1vhr B: [32652]
Details for d1vhrb_
PDB Entry: 1vhr (more details), 2.1 Å
PDB Description: human vh1-related dual-specificity phosphatase
SCOP Domain Sequences for d1vhrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhrb_ c.45.1.1 (B:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens)}
svqdlndllsdgsgcyslpsqpcnevtpriyvgnasvaqdipklqklgithvlnaaegrs
fmhvntnanfykdsgitylgikandtqefnlsayferaadfidqalaqkngrvlvhcreg
ysrsptlviaylmmrqkmdvksalsivrqnreigpndgflaqlcqlndrlakegklkp
SCOP Domain Coordinates for d1vhrb_:
Click to download the PDB-style file with coordinates for d1vhrb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vhrb_:
- d1vhrb_ appears in SCOP 1.57
- d1vhrb_ appears in the current release, SCOPe 2.08
View in 3D
