Lineage for d5ft6a_ (5ft6 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897076Species Escherichia coli K-12 [TaxId:83333] [226746] (6 PDB entries)
  8. 2897084Domain d5ft6a_: 5ft6 A: [326519]
    automated match to d4lw2a_
    complexed with gol, peg, plp

Details for d5ft6a_

PDB Entry: 5ft6 (more details), 2.05 Å

PDB Description: crystal structure of the cysteine desulfurase csda (s-sulfonic acid) from escherichia coli at 2.050 angstroem resolution
PDB Compounds: (A:) cysteine desulfurase csda

SCOPe Domain Sequences for d5ft6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ft6a_ c.67.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqr
ltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehh
anlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdla
raitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkselle
amspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaesw
srslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhcaq
pllaelgvtgtlrasfapyntksdvdalvnavdralellvd

SCOPe Domain Coordinates for d5ft6a_:

Click to download the PDB-style file with coordinates for d5ft6a_.
(The format of our PDB-style files is described here.)

Timeline for d5ft6a_: