Lineage for d5ts9h_ (5ts9 H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345538Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2345539Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2345602Family a.130.1.0: automated matches [237401] (1 protein)
    not a true family
  6. 2345603Protein automated matches [237402] (7 species)
    not a true protein
  7. 2345625Species Paraburkholderia phymatum [TaxId:391038] [326517] (1 PDB entry)
  8. 2345633Domain d5ts9h_: 5ts9 H: [326518]
    automated match to d4oj7a_

Details for d5ts9h_

PDB Entry: 5ts9 (more details), 1.95 Å

PDB Description: crystal structure of chorismate mutase from burkholderia phymatum
PDB Compounds: (H:) chorismate mutase

SCOPe Domain Sequences for d5ts9h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ts9h_ a.130.1.0 (H:) automated matches {Paraburkholderia phymatum [TaxId: 391038]}
aqqdafvplvrsmadrlntadqvalskwdtgqpvydgqreaqvianaatmaseygltaed
ainifsdqveankevqyallnnwrrqgdapatprqslagvirpildklqasimqnlqsva
plrsiadchalvasavgqvaeqasldvlhraaldravaricvk

SCOPe Domain Coordinates for d5ts9h_:

Click to download the PDB-style file with coordinates for d5ts9h_.
(The format of our PDB-style files is described here.)

Timeline for d5ts9h_: