Lineage for d1vhra_ (1vhr A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698670Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 698671Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 698672Family c.45.1.1: Dual specificity phosphatase-like [52800] (8 proteins)
  6. 698716Protein VH1-related dual-specificity phosphatase, VHR [52801] (1 species)
  7. 698717Species Human (Homo sapiens) [TaxId:9606] [52802] (2 PDB entries)
  8. 698718Domain d1vhra_: 1vhr A: [32651]

Details for d1vhra_

PDB Entry: 1vhr (more details), 2.1 Å

PDB Description: human vh1-related dual-specificity phosphatase
PDB Compounds: (A:) human vh1-related dual-specificity phosphatase vhr

SCOP Domain Sequences for d1vhra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]}
svqdlndllsdgsgcyslpsqpcnevtpriyvgnasvaqdipklqklgithvlnaaegrs
fmhvntnanfykdsgitylgikandtqefnlsayferaadfidqalaqkngrvlvhcreg
ysrsptlviaylmmrqkmdvksalsivrqnreigpndgflaqlcqlndrlakegklkp

SCOP Domain Coordinates for d1vhra_:

Click to download the PDB-style file with coordinates for d1vhra_.
(The format of our PDB-style files is described here.)

Timeline for d1vhra_: