SCOPe 2.07: Domain d5tmca2: 5tmc A:50-172

Lineage for d5tmca2 (5tmc A:50-172)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)
   automatically mapped to Pfam PF01000

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)

6. Protein RNA polymerase alpha subunit [56555] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d5tmca2: 5tmc A:50-172 [326505]
   Other proteins in same PDB: d5tmca1, d5tmcb1, d5tmcc_, d5tmcd_, d5tmce_, d5tmcf1, d5tmcf2, d5tmcf3
   automated match to d1smya2
   complexed with g4p, mg, po4, zn

Details for d5tmca2

PDB Entry: 5tmc, 2.71 Å

PDB Description: re-refinement of thermus thermopiles dna-directed rna polymerase structure

PDB Compounds: (A:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d5tmca2:

Sequence; same for both SEQRES and ATOM records:

>d5tmca2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

Timeline for d5tmca2:

• d5tmca2 first appeared in SCOPe 2.06
  
• d5tmca2 appears in the current release, SCOPe 2.08