Lineage for d5gljb_ (5glj B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786026Protein Phosphatase hPTP1e [50168] (2 species)
  7. 2786027Species Human (Homo sapiens) [TaxId:9606] [50169] (9 PDB entries)
  8. 2786030Domain d5gljb_: 5glj B: [326497]
    Other proteins in same PDB: d5glja2, d5gljc2, d5gljd2
    automated match to d2h3lb_
    complexed with cl

Details for d5gljb_

PDB Entry: 5glj (more details), 1.6 Å

PDB Description: crystal structure of pdz1 domain of human protein tyrosine phosphatase ptp-bas
PDB Compounds: (B:) Tyrosine-protein phosphatase non-receptor type 13

SCOPe Domain Sequences for d5gljb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gljb_ b.36.1.1 (B:) Phosphatase hPTP1e {Human (Homo sapiens) [TaxId: 9606]}
spereitlvnlkkdakyglgfqiiggekmgrldlgifissvapggpadldgclkpgdrli
svnsvslegvshhaaieilqnapedvtlvisqp

SCOPe Domain Coordinates for d5gljb_:

Click to download the PDB-style file with coordinates for d5gljb_.
(The format of our PDB-style files is described here.)

Timeline for d5gljb_: