![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
![]() | Protein Phosphatase hPTP1e [50168] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50169] (9 PDB entries) |
![]() | Domain d5gljb_: 5glj B: [326497] Other proteins in same PDB: d5glja2, d5gljc2, d5gljd2 automated match to d2h3lb_ complexed with cl |
PDB Entry: 5glj (more details), 1.6 Å
SCOPe Domain Sequences for d5gljb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gljb_ b.36.1.1 (B:) Phosphatase hPTP1e {Human (Homo sapiens) [TaxId: 9606]} spereitlvnlkkdakyglgfqiiggekmgrldlgifissvapggpadldgclkpgdrli svnsvslegvshhaaieilqnapedvtlvisqp
Timeline for d5gljb_: