![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species) PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103301] (67 PDB entries) |
![]() | Domain d5hnix_: 5hni X: [326491] automated match to d1r0pa_ complexed with 63b |
PDB Entry: 5hni (more details), 1.71 Å
SCOPe Domain Sequences for d5hnix_:
Sequence, based on SEQRES records: (download)
>d5hnix_ d.144.1.7 (X:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} vqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavkslnritdigevs qfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnptvkdli gfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmydkefdsvhnktg aklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrl lqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnaty
>d5hnix_ d.144.1.7 (X:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} vqavqhvvigpgcvyhgtlkihcavksvsqfltegiimkdfshpnvlsllgiclrsegsp lvvlpymkhgdlrnfirnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmld ekftvkvadfglardmywmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfd itvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvh vnaty
Timeline for d5hnix_: