Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) |
Family c.44.2.1: PTS system, Lactose/Cellobiose specific IIB subunit [52795] (3 proteins) Pfam PF02302 |
Protein Enzyme IIB-cellobiose [52796] (1 species) of the phosphoenol-pyruvate dependent phosphotransferase system |
Species Escherichia coli [TaxId:562] [52797] (3 PDB entries) |
Domain d1iibb_: 1iib B: [32649] |
PDB Entry: 1iib (more details), 1.8 Å
SCOPe Domain Sequences for d1iibb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iibb_ c.44.2.1 (B:) Enzyme IIB-cellobiose {Escherichia coli [TaxId: 562]} kkhiylfssagmstsllvskmraqaekyevpviieafpetlagekgqnadvvllgpqiay mlpeiqrllpnkpvevidsllygkvdglgvlkaavaaikkaaa
Timeline for d1iibb_: