Lineage for d1iiba_ (1iib A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851592Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 1851718Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) (S)
  5. 1851719Family c.44.2.1: PTS system, Lactose/Cellobiose specific IIB subunit [52795] (3 proteins)
    Pfam PF02302
  6. 1851720Protein Enzyme IIB-cellobiose [52796] (1 species)
    of the phosphoenol-pyruvate dependent phosphotransferase system
  7. 1851721Species Escherichia coli [TaxId:562] [52797] (3 PDB entries)
  8. 1851722Domain d1iiba_: 1iib A: [32648]

Details for d1iiba_

PDB Entry: 1iib (more details), 1.8 Å

PDB Description: crystal structure of iibcellobiose from escherichia coli
PDB Compounds: (A:) enzyme iib of the cellobiose-specific phosphotransferase system

SCOPe Domain Sequences for d1iiba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iiba_ c.44.2.1 (A:) Enzyme IIB-cellobiose {Escherichia coli [TaxId: 562]}
kkhiylfssagmstsllvskmraqaekyevpviieafpetlagekgqnadvvllgpqiay
mlpeiqrllpnkpvevidsllygkvdglgvlkaavaaikkaaa

SCOPe Domain Coordinates for d1iiba_:

Click to download the PDB-style file with coordinates for d1iiba_.
(The format of our PDB-style files is described here.)

Timeline for d1iiba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1iibb_